Details from NCBI annotation

Gene Symbol Anapc13
Gene Name anaphase promoting complex subunit 13, transcript variant X4
Entrez Gene ID 101724802

Database interlinks

Part of NW_004624730.1 (Scaffold)

For more information consult the page for NW_004624730.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

ANAPC13 ENSCPOG00000001460 (Guinea pig)

Gene Details

anaphase promoting complex subunit 13

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000001319, Guinea pig)

Protein Percentage 100.0%
CDS Percentage 92.79%
Ka/Ks Ratio 0.001 (Ka = 0.0004, Ks = 0.3605)

ANAPC13 ENSG00000129055 (Human)

Gene Details

anaphase promoting complex subunit 13

External Links

Gene Match (Ensembl Protein ID: ENSP00000421842, Human)

Protein Percentage 100.0%
CDS Percentage 94.14%
Ka/Ks Ratio 0.001 (Ka = 0.0003, Ks = 0.2668)

Anapc13 ENSMUSG00000035048 (Mouse)

Gene Details

anaphase promoting complex subunit 13

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000039761, Mouse)

Protein Percentage 95.95%
CDS Percentage 87.84%
Ka/Ks Ratio 0.06202 (Ka = 0.0328, Ks = 0.5288)

Anapc13 ENSRNOG00000008459 (Rat)

Gene Details

anaphase promoting complex subunit 13 (Anapc13), mRNA

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000011203, Rat)

Protein Percentage 95.95%
CDS Percentage 87.39%
Ka/Ks Ratio 0.04276 (Ka = 0.026, Ks = 0.6075)

Genome Location

Sequence Coding sequence

Length: 225 bp    Location: 10811226..10805353   Strand: -
>XM_004834272.1
ATGGATAGTGAGGTACAGAGAGATGGAAGGATCTTGGATTTGATTGATGATGCTTGGCGAGAAGACAAGTTGCCTTATGAGGATGTTGCAATACCACTGAATGAACTTCCTGAACCTGAACAAGACAACGGTGGCACCACAGAATCTGTGAAAGAACAGGAAATGAAGTGGACAGACTTGGCCTTACAGTACCTCCACGAGAATGTCCCTCCCATCGGAAACTGA

Related Sequences

XP_004834329.1 Protein

Anapc13 PREDICTED: anaphase-promoting complex subunit 13 isoform X4 [Heterocephalus glaber]

Length: 74 aa      View alignments
>XP_004834329.1
MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPIGN