Sequence details NCBI ID: XP_004834329.1 (Protein)

Details from NCBI annotation

Gene Symbol Anapc13
Protein Name PREDICTED: anaphase-promoting complex subunit 13 isoform X4 [Heterocephalus glaber]

Database interlinks

Part of XM_004834272.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004834272.1 (Coding sequence)

Sequence Protein

Length: 74 aa     
View alignmentsRaw sequence   
>XP_004834329.1
MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPIGN