Sequence details NCBI ID: XP_004873893.1 (Protein)

Details from NCBI annotation

Gene Symbol Rpusd1
Protein Name PREDICTED: RNA pseudouridylate synthase domain-containing protein 1 [Heterocephalus glaber]

Database interlinks

Part of XM_004873836.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004873836.1 (Coding sequence)

Sequence Protein

Length: 306 aa     
View alignmentsRaw sequence   
>XP_004873893.1
MEPGSVENLSIVYQSRDFLVVNKHWDLRIDCKTWRETLTLQKQLRHHFPELADPDTCYGFRFCHQLDFSTSGALCVALNKAAAGSAYRCFKERRVTKAYLALVRGHIQESQLTVSYAIGRNSTEGRTHTMCIEGTQGCENPKPSLTELLVLEHGLYDGNPVSKVLLKPLTGRTHQLRVHCSALGHPIVGDLTYGQATGQEDQPFRMMLHAFYLRIPTLAECVEACTPDPFLSTLDACWCPHTLVQPLDQLLQALRAAPDPGPMDGDPGSCSPPVPLPGPGQGPPETEAQRTSCLQWLLEWTLEPDN