Sequence details NCBI ID: XP_004872910.1 (Protein)

Details from NCBI annotation

Gene Symbol Cartpt
Protein Name PREDICTED: cocaine- and amphetamine-regulated transcript protein isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004872853.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004872853.1 (Coding sequence)

Sequence Protein

Length: 128 aa     
View alignmentsRaw sequence   
>XP_004872910.1
MERSRLRLLPLLGAALLLMLPLLGAGAQDDAELQPRALDISAVEDTSHEKELPRWQLGLRGDVLQIEALQEVLKKLKSKRIPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL