Details from NCBI annotation

Gene Symbol Cartpt
Gene Name CART prepropeptide, transcript variant X1
Entrez Gene ID 101710231

Database interlinks

Part of NW_004624905.1 (Scaffold)

For more information consult the page for NW_004624905.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

CARTPT ENSCPOG00000021953 (Guinea pig)

Gene Details

CART prepropeptide

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000021136, Guinea pig)

Protein Percentage 93.91%
CDS Percentage 93.04%
Ka/Ks Ratio 0.12446 (Ka = 0.0281, Ks = 0.2261)

CARTPT ENSG00000164326 (Human)

Gene Details

CART prepropeptide

External Links

Gene Match (Ensembl Protein ID: ENSP00000296777, Human)

Protein Percentage 93.04%
CDS Percentage 88.12%
Ka/Ks Ratio 0.06099 (Ka = 0.0324, Ks = 0.5316)

Cartpt ENSMUSG00000021647 (Mouse)

Gene Details

CART prepropeptide

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000022150, Mouse)

Protein Percentage 90.63%
CDS Percentage 86.2%
Ka/Ks Ratio 0.0964 (Ka = 0.0504, Ks = 0.5233)

Cartpt ENSRNOG00000017712 (Rat)

Gene Details

CART prepropeptide (Cartpt), mRNA

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000023869, Rat)

Protein Percentage 91.41%
CDS Percentage 86.98%
Ka/Ks Ratio 0.09877 (Ka = 0.0469, Ks = 0.4748)

Genome Location

Sequence Coding sequence

Length: 387 bp    Location: 751223..752915   Strand: +
>XM_004872853.1
ATGGAGAGGTCCCGCCTTCGGCTGCTGCCCCTCCTAGGCGCTGCGCTGCTCCTGATGCTACCTCTGCTGGGCGCTGGTGCACAGGACGACGCTGAGCTGCAGCCCCGAGCCCTGGACATCTCCGCCGTGGAGGATACCTCCCACGAGAAGGAGCTGCCAAGGTGGCAACTTGGGCTCCGGGGCGATGTATTGCAGATTGAAGCGCTGCAGGAAGTCTTGAAGAAGCTCAAGAGTAAACGTATTCCAATCTATGAGAAGAAGTATGGCCAAGTTCCCATGTGTGATGCTGGAGAACAATGCGCAGTTCGAAAAGGAGCCAGGATTGGGAAGCTGTGCGACTGCCCCCGAGGAACCTCCTGTAATTCCTTCCTCTTGAAGTGCTTATGA

Related Sequences

XP_004872910.1 Protein

Cartpt PREDICTED: cocaine- and amphetamine-regulated transcript protein isoform X1 [Heterocephalus glaber]

Length: 128 aa      View alignments
>XP_004872910.1
MERSRLRLLPLLGAALLLMLPLLGAGAQDDAELQPRALDISAVEDTSHEKELPRWQLGLRGDVLQIEALQEVLKKLKSKRIPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL