Sequence details NCBI ID: XP_004868978.1 (Protein)

Details from NCBI annotation

Gene Symbol Lsm6
Protein Name PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004868921.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004868921.1 (Coding sequence)

Sequence Protein

Length: 80 aa     
View alignmentsRaw sequence   
>XP_004868978.1
MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM