Sequence details NCBI ID: XP_004867972.1 (Protein)

Details from NCBI annotation

Gene Symbol Map1lc3a
Protein Name PREDICTED: microtubule-associated proteins 1A/1B light chain 3A isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004867915.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004867915.1 (Coding sequence)

Sequence Protein

Length: 121 aa     
View alignmentsRaw sequence   
>XP_004867972.1
MPSDRPFKQRRSFADRSKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF