Sequence details NCBI ID: XP_004864765.1 (Protein)

Details from NCBI annotation

Gene Symbol Hcfc1r1
Protein Name PREDICTED: host cell factor C1 regulator 1 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004864708.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004864708.1 (Coding sequence)

Sequence Protein

Length: 116 aa     
View alignmentsRaw sequence   
>XP_004864765.1
MILQQPLERASPGLALRATSGVTRGLDTREALRKQFLTEENMATHFSRLSLHNDHPYCSPPMPFLPALPPLRSPCSELFLWRYPGSLIPEALRLLRLGDTPTPHFAATPAGDIMEL