Sequence details NCBI ID: XP_004859653.1 (Protein)

Details from NCBI annotation

Gene Symbol Cbx1
Protein Name PREDICTED: chromobox protein homolog 1 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004859596.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004859596.1 (Coding sequence)

Sequence Protein

Length: 185 aa     
View alignmentsRaw sequence   
>XP_004859653.1
MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVRCPQVVISFYEERLTWHSYPSEDDDKKDDKN