Sequence details NCBI ID: XP_004858696.1 (Protein)

Details from NCBI annotation

Gene Symbol Tnfsf13b
Protein Name PREDICTED: tumor necrosis factor ligand superfamily member 13B [Heterocephalus glaber]

Database interlinks

Part of XM_004858639.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004858639.1 (Coding sequence)

Sequence Protein

Length: 293 aa     
Raw sequence   
>XP_004858696.1
MSRALRSLTPRPRPTKCERGTDEPAVRSRLFPGLEEAEEMKAARAAIPAQQRSPSARPSGTSSPLLAASLLLALLSGGLTVLSFRRVAALQADLDGLRAQLQGPRASGAAGPTVRVSAGLRGLLAPAAPGRNSSGSSRQRRAAERPGATVTQDCLQLIADSDTPTIRKGSYTFVPWLLSFKRGRALEEKENKIVVKEPGYFFIYGQVLYTDSTFAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDEIQLAIPRENAQISRDGDGTFFGALKLL