Sequence details NCBI ID: XP_004856710.1 (Protein)

Details from NCBI annotation

Gene Symbol Pafah1b2
Protein Name PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004856653.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004856653.1 (Coding sequence)

Sequence Protein

Length: 229 aa     
View alignmentsRaw sequence   
>XP_004856710.1
MSQGDSNPAAIPHAAEDVQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVRLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLNLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA