Sequence details NCBI ID: XP_004855659.1 (Protein)

Details from NCBI annotation

Gene Symbol Snapc5
Protein Name PREDICTED: snRNA-activating protein complex subunit 5 isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004855602.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004855602.1 (Coding sequence)

Sequence Protein

Length: 109 aa     
View alignmentsRaw sequence   
>XP_004855659.1
MLSRLQELRKEEETLLRLKAALHDQLNRLKVEELALRSMINSTAEDGKVSFHSAAEQSQDVSFIKYKPREGMQSLLCSFLLLSKIVVKHITKPQGFWELPRCWRLNPEP