Sequence details NCBI ID: XP_004855425.1 (Protein)

Details from NCBI annotation

Gene Symbol Lsm1
Protein Name PREDICTED: U6 snRNA-associated Sm-like protein LSm1 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004855368.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004855368.1 (Coding sequence)

Sequence Protein

Length: 133 aa     
View alignmentsRaw sequence   
>XP_004855425.1
MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY