Sequence details NCBI ID: XP_004850220.1 (Protein)

Details from NCBI annotation

Gene Symbol Polr2k
Protein Name PREDICTED: DNA-directed RNA polymerases I, II, and III subunit RPABC4 [Heterocephalus glaber]

Database interlinks

Part of XM_004850163.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004850163.1 (Coding sequence)

Sequence Protein

Length: 58 aa     
View alignmentsRaw sequence   
>XP_004850220.1
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR