Details from NCBI annotation

Gene Symbol Polr2k
Gene Name polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa
Entrez Gene ID 101718217

Database interlinks

Part of NW_004624763.1 (Scaffold)

For more information consult the page for NW_004624763.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

POLR2K ENSCPOG00000015704 (Guinea pig)

Gene Details

polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000014159, Guinea pig)

Protein Percentage 90.91%
CDS Percentage 94.55%
Ka/Ks Ratio 0.38208 (Ka = 0.0485, Ks = 0.1269)

POLR2K ENSG00000147669 (Human)

Gene Details

polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa

External Links

Gene Match (Ensembl Protein ID: ENSP00000342889, Human)

Protein Percentage 100.0%
CDS Percentage 94.83%
Ka/Ks Ratio 0.001 (Ka = 0.0003, Ks = 0.3014)

Polr2k ENSMUSG00000045996 (Mouse)

Gene Details

polymerase (RNA) II (DNA directed) polypeptide K

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000051968, Mouse)

Protein Percentage 98.28%
CDS Percentage 91.95%
Ka/Ks Ratio 0.01494 (Ka = 0.0073, Ks = 0.4917)

Polr2k ENSRNOG00000010408 (Rat)

Gene Details

polymerase (RNA) II (DNA directed) polypeptide K

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000013869, Rat)

Protein Percentage 100.0%
CDS Percentage 93.1%
Ka/Ks Ratio 0.001 (Ka = 0.0004, Ks = 0.4376)

Genome Location

Sequence Coding sequence

Length: 177 bp    Location: 7068012..7071799   Strand: +
>XM_004850163.1
ATGGACACTCAGAAGGACGTTCAACCTCCAAAGCAGCAGCCAATGATATATATCTGTGGAGAATGTCACACAGAAAATGAAATTAAATCCAGGGATCCAATCAGATGTAGAGAATGTGGATATAGAATAATGTACAAGAAAAGAACTAAAAGATTGGTGGTTTTTGATGCTCGATGA

Related Sequences

XP_004850220.1 Protein

Polr2k PREDICTED: DNA-directed RNA polymerases I, II, and III subunit RPABC4 [Heterocephalus glaber]

Length: 58 aa      View alignments
>XP_004850220.1
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR