Sequence details NCBI ID: XP_004849022.1 (Protein)

Details from NCBI annotation

Gene Symbol Cacfd1
Protein Name PREDICTED: calcium channel flower homolog isoform X4 [Heterocephalus glaber]

Database interlinks

Part of XM_004848965.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004848965.1 (Coding sequence)

Sequence Protein

Length: 171 aa     
View alignmentsRaw sequence   
>XP_004849022.1
MSGSGGPGAPAGPAPPAQEEGMTWWWRWLCRLSGVLGAVSCAVSGLFSCITIHPLNIAAGVWMIMNAFILLLCEVPFCCQFVEFANAVAERVDQLRSWQKAVFYCGMAVVPIIMSLTLTTLLGNAVAFATGVLYGLSALGKKGDAISYARIQQQKQQVDEEKLVETVEGEL