Sequence details NCBI ID: XP_004848715.1 (Protein)

Details from NCBI annotation

Gene Symbol Sub1
Protein Name PREDICTED: activated RNA polymerase II transcriptional coactivator p15 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004848658.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004848658.1 (Coding sequence)

Sequence Protein

Length: 127 aa     
View alignmentsRaw sequence   
>XP_004848715.1
MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL