Sequence details NCBI ID: XP_004846648.1 (Protein)

Details from NCBI annotation

Gene Symbol Tomm6
Protein Name PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004846591.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004846591.1 (Coding sequence)

Sequence Protein

Length: 74 aa     
View alignmentsRaw sequence   
>XP_004846648.1
MASSGVSVGVAGSANENPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQPGV