Details from NCBI annotation

Gene Symbol Tomm6
Gene Name translocase of outer mitochondrial membrane 6 homolog (yeast), transcript variant X2
Entrez Gene ID 101710551

Database interlinks

Part of NW_004624754.1 (Scaffold)

For more information consult the page for NW_004624754.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

TOMM6 ENSCPOG00000026731 (Guinea pig)

Gene Details

translocase of outer mitochondrial membrane 6 homolog (yeast)

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000016893, Guinea pig)

Protein Percentage 94.59%
CDS Percentage 95.5%
Ka/Ks Ratio 0.24462 (Ka = 0.0259, Ks = 0.1059)

TOMM6 ENSG00000214736 (Human)

Gene Details

translocase of outer mitochondrial membrane 6 homolog (yeast)

External Links

Gene Match (Ensembl Protein ID: ENSP00000381859, Human)

Protein Percentage 93.24%
CDS Percentage 90.09%
Ka/Ks Ratio 0.11714 (Ka = 0.0393, Ks = 0.3358)

Tomm6 ENSMUSG00000033475 (Mouse)

Gene Details

translocase of outer mitochondrial membrane 6 homolog (yeast)

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000108927, Mouse)

Protein Percentage 89.19%
CDS Percentage 85.14%
Ka/Ks Ratio 0.09522 (Ka = 0.0598, Ks = 0.6277)

Tomm6 ENSRNOG00000046316 (Rat)

Gene Details

Protein Tomm6; RCG43475

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000065096, Rat)

Protein Percentage 91.89%
CDS Percentage 87.84%
Ka/Ks Ratio 0.0954 (Ka = 0.0462, Ks = 0.484)

Genome Location

Sequence Coding sequence

Length: 225 bp    Location: 17282675..17276489   Strand: -
>XM_004846591.1
ATGGCTTCCAGTGGGGTCTCGGTGGGCGTTGCGGGCTCGGCAAACGAAAACCCCGAAATTCCGGACAACGTGGGAGATTGGCTCCGAGGCGTCTACCGCTTTGCCACCGATAGGAATGACTTCCGGAGGAACTTGATCCTCAATTTGGGACTCTTCGCTGCAGGAGTTTGGCTGGCCAGGAACTTGAGTGACATTGATCTAATGGCACCTCAGCCAGGGGTGTAG

Related Sequences

XP_004846648.1 Protein

Tomm6 PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X2 [Heterocephalus glaber]

Length: 74 aa      View alignments
>XP_004846648.1
MASSGVSVGVAGSANENPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQPGV