Sequence details NCBI ID: XP_004846261.1 (Protein)

Details from NCBI annotation

Gene Symbol Lrrc20
Protein Name PREDICTED: leucine-rich repeat-containing protein 20 isoform X4 [Heterocephalus glaber]

Database interlinks

Part of XM_004846204.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004846204.1 (Coding sequence)

Sequence Protein

Length: 184 aa     
View alignmentsRaw sequence   
>XP_004846261.1
MLKKMGEAVARVARKVNETVESSSDTLDLAECKLVSFPIGIYKVLRNVSDQIHLITLANNELKSLTSKFMTTFSQLRELRLEGNFLHRLPNEVSNLQHLKAIDLSRNQFRDFPEQLTTLPVLETINLEENEIMDVPVEKLATMPALRTVNLRLNPLSAEVRVIAPPLIKFDLVTSPEGARAPPP