Sequence details NCBI ID: XP_004846089.1 (Protein)

Details from NCBI annotation

Gene Symbol Zc2hc1b
Protein Name PREDICTED: zinc finger C2HC domain-containing protein 1B [Heterocephalus glaber]

Database interlinks

Part of XM_004846032.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004846032.1 (Coding sequence)

Sequence Protein

Length: 248 aa     
View alignmentsRaw sequence   
>XP_004846089.1
MSGAEPFLADGSQELFPCEVCGRRFAADVLKRHGPICRKLFHKKRKLFNSLKQRLQGMDIPTVRKAPPSKSQPVRKSNWRQQHEDFINAIQSVKQCTLAVREGRPLPPAPTPSVNPDYIQCPYCMRRFNETAAGRHINFCKDQSSRRVFDPAQTAAKLASRAQGRAQASPRKEPTVTRAVGALLQSRPMEAKTEVSTKSSWLSETLKPGNPTQECHLRERRKGSVCLFRSPLRSSVFLLIYSFLKKSY