Sequence details NCBI ID: XP_004845316.1 (Protein)

Details from NCBI annotation

Gene Symbol Mzt1
Protein Name PREDICTED: mitotic-spindle organizing protein 1 isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004845259.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004845259.1 (Coding sequence)

Sequence Protein

Length: 82 aa     
View alignmentsRaw sequence   
>XP_004845316.1
MASGGGAGAAGAAAAANLNAVRETMDVLLEISKILNTGLDMETLSICVRLCEQGINPEALSSVIKELRKATEALKAAENTTS