Details from NCBI annotation

Gene Symbol Mzt1
Gene Name mitotic spindle organizing protein 1, transcript variant X1
Entrez Gene ID 101723923

Database interlinks

Part of NW_004624751.1 (Scaffold)

For more information consult the page for NW_004624751.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

MZT1 ENSCPOG00000027206 (Guinea pig)

Gene Details

mitotic spindle organizing protein 1

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000018200, Guinea pig)

Protein Percentage 95.89%
CDS Percentage 95.43%
Ka/Ks Ratio 0.17304 (Ka = 0.0205, Ks = 0.1182)

MZT1 ENSG00000204899 (Human)

Gene Details

mitotic spindle organizing protein 1

External Links

Gene Match (Ensembl Protein ID: ENSP00000367049, Human)

Protein Percentage 93.9%
CDS Percentage 90.65%
Ka/Ks Ratio 0.08236 (Ka = 0.0296, Ks = 0.3598)

Mzt1 ENSMUSG00000033186 (Mouse)

Gene Details

mitotic spindle organizing protein 1

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000037557, Mouse)

Protein Percentage 92.31%
CDS Percentage 88.46%
Ka/Ks Ratio 0.07433 (Ka = 0.0364, Ks = 0.4894)

Mzt1 ENSRNOG00000024813 (Rat)

Gene Details

Protein Mzt1

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000030357, Rat)

Protein Percentage 94.44%
CDS Percentage 87.5%
Ka/Ks Ratio 0.03381 (Ka = 0.0253, Ks = 0.7481)

Genome Location

Sequence Coding sequence

Length: 249 bp    Location: 27814973..27832343   Strand: +
>XM_004845259.1
ATGGCGAGCGGCGGTGGCGCCGGGGCGGCGGGGGCTGCGGCGGCGGCGAACCTCAACGCGGTGAGGGAGACCATGGACGTTCTGCTTGAGATTTCAAAAATTTTGAATACTGGCTTAGATATGGAAACTCTGTCTATTTGTGTACGACTTTGTGAACAAGGCATTAACCCAGAAGCTTTGTCTTCAGTCATTAAGGAGCTTCGCAAGGCTACTGAAGCACTAAAGGCTGCTGAAAATACAACAAGCTGA

Related Sequences

XP_004845316.1 Protein

Mzt1 PREDICTED: mitotic-spindle organizing protein 1 isoform X1 [Heterocephalus glaber]

Length: 82 aa      View alignments
>XP_004845316.1
MASGGGAGAAGAAAAANLNAVRETMDVLLEISKILNTGLDMETLSICVRLCEQGINPEALSSVIKELRKATEALKAAENTTS