Sequence details NCBI ID: XP_004835460.1 (Protein)

Details from NCBI annotation

Gene Symbol Lysmd2
Protein Name PREDICTED: lysM and putative peptidoglycan-binding domain-containing protein 2 [Heterocephalus glaber]

Database interlinks

Part of XM_004835403.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004835403.1 (Coding sequence)

Sequence Protein

Length: 124 aa     
View alignmentsRaw sequence   
>XP_004835460.1
MEQIKRANKLFTNDCIFLKKTLSIPVRSEQPLVFNGLSSSDSPESEAGDSSFPPSEELGVAGDELLPPSPQGPAPRPVQPKEVSARDFLDRVDLQIKLSTQAAQRLKQESRDEQSPYATSLYHS