Details from NCBI annotation

Gene Symbol Ctxn1
Gene Name cortexin 1
Entrez Gene ID 101712833

Database interlinks

Part of NW_004624828.1 (Scaffold)

For more information consult the page for NW_004624828.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

CTXN1 ENSCPOG00000020394 (Guinea pig)

Gene Details

cortexin 1

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000016523, Guinea pig)

Protein Percentage 98.78%
CDS Percentage 93.5%
Ka/Ks Ratio 0.00363 (Ka = 0.0048, Ks = 1.3097)

CTXN1 ENSG00000178531 (Human)

Gene Details

cortexin 1

External Links

Gene Match (Ensembl Protein ID: ENSP00000313226, Human)

Protein Percentage 100.0%
CDS Percentage 95.53%
Ka/Ks Ratio 0.001 (Ka = 0.0009, Ks = 0.8647)

Ctxn1 ENSMUSG00000048644 (Mouse)

Gene Details

cortexin 1

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000057115, Mouse)

Protein Percentage 96.34%
CDS Percentage 90.65%
Ka/Ks Ratio 0.00817 (Ka = 0.0152, Ks = 1.8656)

Ctxn1 ENSRNOG00000001057 (Rat)

Gene Details

cortexin 1 (Ctxn1), mRNA

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000001399, Rat)

Protein Percentage 97.56%
CDS Percentage 89.84%
Ka/Ks Ratio 0.00484 (Ka = 0.0103, Ks = 2.1348)

Genome Location

Sequence Coding sequence

Length: 249 bp    Location: 888433..887005   Strand: -
>XM_004865388.1
ATGAGCGCGACGTGGACGCTGTCGCCGGAGCCGCTGCCCCCGTCGACTGGGCCCCCAGTGGGCGCGGGGCTGGACGCGGAGCAACGCACTGTGTTCGCCTTCGTGCTCTGCCTGCTCGTGGTGCTGGTGCTGCTGATGGTGCGCTGCGTGCGCATCCTGCTGGACCCCTACAGCCGCATGCCCGCCTCGTCCTGGACCGACCACAAGGAGGCGCTGGAGCGCGGGCAGTTCGACTACGCGCTGGTGTGA

Related Sequences

XP_004865445.1 Protein

Ctxn1 PREDICTED: cortexin-1 [Heterocephalus glaber]

Length: 82 aa      View alignments
>XP_004865445.1
MSATWTLSPEPLPPSTGPPVGAGLDAEQRTVFAFVLCLLVVLVLLMVRCVRILLDPYSRMPASSWTDHKEALERGQFDYALV