Details from NCBI annotation

Gene Symbol Ccl22
Gene Name chemokine (C-C motif) ligand 22
Entrez Gene ID 101699782

Database interlinks

Part of NW_004624746.1 (Scaffold)

For more information consult the page for NW_004624746.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

CCL22 ENSCPOG00000004546 (Guinea pig)

Gene Details

chemokine (C-C motif) ligand 22

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000004096, Guinea pig)

Protein Percentage 87.1%
CDS Percentage 87.81%
Ka/Ks Ratio 0.09685 (Ka = 0.0604, Ks = 0.6238)

CCL22 ENSG00000102962 (Human)

Gene Details

chemokine (C-C motif) ligand 22

External Links

Gene Match (Ensembl Protein ID: ENSP00000219235, Human)

Protein Percentage 67.74%
CDS Percentage 78.49%
Ka/Ks Ratio 0.3153 (Ka = 0.1905, Ks = 0.6043)

Ccl22 ENSMUSG00000031779 (Mouse)

Gene Details

chemokine (C-C motif) ligand 22

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000034231, Mouse)

Protein Percentage 65.22%
CDS Percentage 72.83%
Ka/Ks Ratio 0.2566 (Ka = 0.2527, Ks = 0.9847)

Ccl22 ENSRNOG00000016535 (Rat)

Gene Details

chemokine (C-C motif) ligand 22 (Ccl22), mRNA

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000022167, Rat)

Protein Percentage 66.3%
CDS Percentage 75.72%
Ka/Ks Ratio 0.22083 (Ka = 0.2079, Ks = 0.9415)

Genome Location

Sequence Coding sequence

Length: 282 bp    Location: 28779818..28695153   Strand: -
>XM_004843174.1
ATGGCCGGCCTACAGGCTCCACTCCTGGCCGGCCTCGTCTTCCTTTCGGTGATGCTTCAGGCAACCAACGCAGGGCCGTATGGCGCCAATGTGGAGGACAGCATCTGCTGCCGGGACTTCGTCCGCCACCCCCTGCCGCTTCGCGTGGTGAAGGACTTCTACTGGACCTCGGGCTCCTGCCGTAGGACTGGCATCGTCTTACAAACCGTCAAGGACCGGGAGATCTGTGCCAACCCCAAACTGCCCTGGGTAAAGAAGATTCTCCAGAAGCTGAGCTCATGA

Related Sequences

XP_004843231.1 Protein

Ccl22 PREDICTED: c-C motif chemokine 22 [Heterocephalus glaber]

Length: 93 aa      View alignments
>XP_004843231.1
MAGLQAPLLAGLVFLSVMLQATNAGPYGANVEDSICCRDFVRHPLPLRVVKDFYWTSGSCRRTGIVLQTVKDREICANPKLPWVKKILQKLSS