Sequence details NCBI ID: XM_004840969.1 (Coding sequence)   Best Hit

Details from NCBI annotation

Gene Symbol Atp5e
Gene Name ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit
Entrez Gene ID 101720946

Database interlinks

Part of NW_004624741.1 (Scaffold)

For more information consult the page for NW_004624741.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

ENSCPOG00000012392 (Guinea pig)

Gene Details

Uncharacterized protein

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000011149, Guinea pig)

Protein Percentage 98.04%
CDS Percentage 96.08%
Ka/Ks Ratio 0.04341 (Ka = 0.0083, Ks = 0.1902)

Atp5e ENSMUSG00000016252 (Mouse)

Gene Details

ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000016396, Mouse)

Protein Percentage 96.08%
CDS Percentage 88.89%
Ka/Ks Ratio 0.02981 (Ka = 0.0178, Ks = 0.5967)

Genome Location

Sequence Coding sequence

Length: 156 bp    Location: 25323769..25319949   Strand: -
Raw sequence   
>XM_004840969.1
ATGGTGGCCTACTGGCGACAGGCTGGACTCAGCTACATTCGATACTCCCAAATCTGTGCAAAAGCAGTGAGGGATGCCCTGAAGACAGAATTCAAAGCAAATGCCGAGAAGAGTTCTGGCAGCAGCATAAAAATTGTGAAAGTGAAAAAAGAATAA

Related Sequences

XP_004841026.1 Protein

Atp5e PREDICTED: ATP synthase subunit epsilon, mitochondrial [Heterocephalus glaber]

Length: 51 aa      
>XP_004841026.1
MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKSSGSSIKIVKVKKE