Details from NCBI annotation

Gene Symbol Serp1
Gene Name stress-associated endoplasmic reticulum protein 1
Entrez Gene ID 101698878

Database interlinks

Part of NW_004624730.1 (Scaffold)

For more information consult the page for NW_004624730.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

SERP1 ENSCPOG00000011272 (Guinea pig)

Gene Details

stress-associated endoplasmic reticulum protein 1

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000010135, Guinea pig)

Protein Percentage 100.0%
CDS Percentage 98.48%
Ka/Ks Ratio 0.001 (Ka = 0.0001, Ks = 0.0783)

SERP1 ENSG00000120742 (Human)

Gene Details

stress-associated endoplasmic reticulum protein 1

External Links

Gene Match (Ensembl Protein ID: ENSP00000420076, Human)

Protein Percentage 100.0%
CDS Percentage 96.97%
Ka/Ks Ratio 0.001 (Ka = 0.0001, Ks = 0.1435)

Serp1 ENSMUSG00000027808 (Mouse)

Gene Details

stress-associated endoplasmic reticulum protein 1

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000029385, Mouse)

Protein Percentage 100.0%
CDS Percentage 94.95%
Ka/Ks Ratio 0.001 (Ka = 0.0003, Ks = 0.2898)

Serp1 ENSRNOG00000011763 (Rat)

Gene Details

stress-associated endoplasmic reticulum protein 1 (Serp1), mRNA

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000017868, Rat)

Protein Percentage 100.0%
CDS Percentage 94.44%
Ka/Ks Ratio 0.001 (Ka = 0.0003, Ks = 0.3438)

Genome Location

Sequence Coding sequence

Length: 201 bp    Location: 27973576..27969185   Strand: -
>XM_004834450.1
ATGGTCGCCAAGCAGCGGATCCGTATGGCCAACGAGAAGCACAGCAAGAACATCACCCAGCGCGGCAACGTCGCCAAGACCTCGAGAAATGCCCCCGAAGAGAAGGCGTCTGTAGGACCCTGGTTACTGGCTCTTTTCATTTTTGTTGTTTGTGGCTCTGCAATTTTCCAGATTATTCAAAGTATCAGGATGGGCATGTGA

Related Sequences

XP_004834507.1 Protein

Serp1 PREDICTED: stress-associated endoplasmic reticulum protein 1 [Heterocephalus glaber]

Length: 66 aa      View alignments
>XP_004834507.1
MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM