Sequence details NCBI ID: XP_004921123.1 (Protein)

Details from NCBI annotation

Gene Symbol unclassified transcription discrepancy
Protein Name PREDICTED: LOW QUALITY PROTEIN: baculoviral IAP repeat containing 7 [Heterocephalus glaber]

Database interlinks

Part of XM_004921066.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004921066.1 (Coding sequence)

Sequence Protein

Length: 232 aa     
View alignmentsRaw sequence   
>XP_004921123.1
MVCGSRAVELPGGCAQEKGVFPYLSGLALITMGPQHGALSPTQLALTTPSTPPRQDQVLVLCGPEPGHGAASHEPVQEPRGHPCLCCRVLHQDCVDGQTLGQLHPLTEEAAEEETGATSLARPSLPGMGSEELLLASFCNWPLTAGVQLELLAAAGFFHTGQQDRVRCLFCYGALQSWEHGDDPXTEHTRWFPRCQFLLRSKGRSFVHRVQEACHPLLSSWVSRLSWGSGGQ