Sequence detailsNCBI ID: XP_004874454.1 (Protein)

Details from NCBI annotation

Gene Symbol Ttc9c
Protein Name PREDICTED: tetratricopeptide repeat protein 9C isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004874397.1 (SequenceType object (2))

There are 4 potential gene matches.

For more information consult the page for XM_004874397.1 (SequenceType object (2))

Sequence SequenceType object (4)

Length: 191 aa     
View alignmentsRaw sequence   
>XP_004874454.1
MEARLQEAQLLKEQGNQRYREGRFRAAAGRYHRALLQLRGLEPGPAPDPGPRASALSAALEDALRSTQLACYNNLAACLLQMEPVNYERVREYSQKVLHRQPDNAKALYRAGVAFFHLQDYEQAQHYLLAAGHRQPKATLQPGRSADVRLSSHLEVGRAVESIGHSQDHWPSVLPKLLPEAELSSPRSRAH