Sequence details NCBI ID: XP_004873510.1 (Protein)

Details from NCBI annotation

Gene Symbol unclassified transcription discrepancy
Protein Name PREDICTED: LOW QUALITY PROTEIN: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 [Heterocephalus glaber]

Database interlinks

Part of XM_004873453.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004873453.1 (Coding sequence)

Sequence Protein

Length: 164 aa     
Raw sequence   
>XP_004873510.1
MAVDVRHFLLGPEVQGSARMAVQKVKQDMPPPGGYGTIDYKRNLPRRGLSGYSMFALGIGTLLYGYWNMIKWNRERRRLQIENLEARLALLPLLQAERDRRVLRMLRENLEEEAIIMKDVPGWKVGESMFHTTRWVTPDIGELYALRTPEEVINASYGFMWFSL