Sequence details NCBI ID: XP_004872869.1 (Protein)

Details from NCBI annotation

Gene Symbol Ppp1r1a
Protein Name PREDICTED: protein phosphatase 1 regulatory subunit 1A isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004872812.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004872812.1 (Coding sequence)

Sequence Protein

Length: 171 aa     
View alignmentsRaw sequence   
>XP_004872869.1
MEPDNSPRKIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEVDEDRIPNPLLKSTLAMSPHQRKKMTRTTPTMKELQTMVEHHLGQQKQGEEPEGAAESTGTQESCPPGISDTEAECRLGTPGTAQKSAGFTPKTQERSSEEPSTEEPSIHIPPLDSQGANSV