Sequence details NCBI ID: XP_004872846.1 (Protein)

Details from NCBI annotation

Gene Symbol Cbx5
Protein Name PREDICTED: chromobox protein homolog 5 isoform X3 [Heterocephalus glaber]

Database interlinks

Part of XM_004872789.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004872789.1 (Coding sequence)

Sequence Protein

Length: 191 aa     
View alignmentsRaw sequence   
>XP_004872846.1
MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS