Sequence details NCBI ID: XP_004872843.1 (Protein)

Details from NCBI annotation

Gene Symbol Smug1
Protein Name PREDICTED: single-strand selective monofunctional uracil DNA glycosylase isoform X3 [Heterocephalus glaber]

Database interlinks

Part of XM_004872786.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004872786.1 (Coding sequence)

Sequence Protein

Length: 272 aa     
View alignmentsRaw sequence   
>XP_004872843.1
MAVPQAFPVGPLPEPAGALMEAQPCAQNLAEGFLEEELRLNVELSQLHFSQPVGLIYNPVDYAWEPHRSYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSVVRDWLGIGGPVLTPAQEHPKRPVLGLQCPQSEVSGARFWGFFRNLCGQPEVFFRHCFVHNLCPLLFLAPSGRNLTPAELPAKQRKQLLGICDAALCRQVQLLGVRLVVGVGRLAEQRARRALAGLTPEVQVEGLLHPSPRNPQANKGWEAVAKERLSELGLLPLLTK