Sequence details NCBI ID: XP_004872112.1 (Protein)

Details from NCBI annotation

Gene Symbol Imp3
Protein Name PREDICTED: U3 small nucleolar ribonucleoprotein protein IMP3 [Heterocephalus glaber]

Database interlinks

Part of XM_004872055.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004872055.1 (Coding sequence)

Sequence Protein

Length: 184 aa     
View alignmentsRaw sequence   
>XP_004872112.1
MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYGLQRREDYTRYNQLSRAVRELARRLRDLSERDPFRVRASAALLNKLYALGLVPTRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLDA