Sequence details NCBI ID: XP_004872019.1 (Protein)

Details from NCBI annotation

Gene Symbol Timm17b
Protein Name PREDICTED: mitochondrial import inner membrane translocase subunit Tim17-B isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004871962.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004871962.1 (Coding sequence)

Sequence Protein

Length: 172 aa     
Raw sequence   
>XP_004872019.1
MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIQHRLRGSVNAVRIRAPQIGGSFAVWGGLFSTIDCGLVRIRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKEGTSATGYPSYQQYH