Sequence details NCBI ID: XP_004871890.1 (Protein)

Details from NCBI annotation

Gene Symbol Ccdc23
Protein Name PREDICTED: coiled-coil domain-containing protein 23 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004871833.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004871833.1 (Coding sequence)

Sequence Protein

Length: 66 aa     
View alignmentsRaw sequence   
>XP_004871890.1
MDPPSRKEKSKVKEPVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE