Sequence details NCBI ID: XP_004871696.1 (Protein)

Details from NCBI annotation

Gene Symbol Ndufb3
Protein Name PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 isoform X4 [Heterocephalus glaber]

Database interlinks

Part of XM_004871639.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004871639.1 (Coding sequence)

Sequence Protein

Length: 100 aa     
Raw sequence   
>XP_004871696.1
MAPGHGHGQEHGHSKMELPDYRQWRIEGTPLETVQKKLAAQGLRDPWGRNEAWRYMGGFTHNVSFVGAFLKGFKWGFAAFVVAVGAEYYLESLNKEKKHH