Sequence details NCBI ID: XP_004871380.1 (Protein)

Details from NCBI annotation

Gene Symbol unclassified transcription discrepancy
Protein Name PREDICTED: LOW QUALITY PROTEIN: cyclin-dependent kinases regulatory subunit 1 [Heterocephalus glaber]

Database interlinks

Part of XM_004871323.1 (Coding sequence)

There are 1 potential gene matches.

For more information consult the page for XM_004871323.1 (Coding sequence)

Sequence Protein

Length: 128 aa     
Raw sequence   
>XP_004871380.1
MELSRLSPKEPIGSAGGVFESEAKEGGSACCWELFGGWRRGAEGLQAANMSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFRRPLPKKPNK