Sequence details NCBI ID: XP_004870811.1 (Protein)

Details from NCBI annotation

Gene Symbol Pmp22
Protein Name PREDICTED: peripheral myelin protein 22 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004870754.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004870754.1 (Coding sequence)

Sequence Protein

Length: 160 aa     
View alignmentsRaw sequence   
>XP_004870811.1
MLLLLLGIIVLHVAVLVLLFVSTIVSQWIVGNGHSTDLWQNCSTSSSGNIQHCSLSSVNEWLQSVQATMILSVIFSVLSLFLFFCQLFTLTKGGRFYITGIFQILAGLCVMSAAAIYTVRHPEWHSNSDYSYGFAYILAWVAFPLALLSGVIYVILRKRE