Sequence details NCBI ID: XP_004870182.1 (Protein)

Details from NCBI annotation

Gene Symbol Hint2
Protein Name PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004870125.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004870125.1 (Coding sequence)

Sequence Protein

Length: 167 aa     
View alignmentsRaw sequence   
>XP_004870182.1
MIGSVQAAQWPPLPSYLIAHLPQAAELSWPGERFLQPRKMAAAMVLAARLSAARRALAAAGVRGSQVRGAASMTDGNEVAKAQQVAPRGAAPTVFSRILDRSLPADILYEDQQLLGHLLLVAKKIAKTEGLRDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG