Sequence details NCBI ID: XP_004869832.1 (Protein)

Details from NCBI annotation

Gene Symbol Ube2l6
Protein Name PREDICTED: ubiquitin/ISG15-conjugating enzyme E2 L6 isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004869775.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004869775.1 (Coding sequence)

Sequence Protein

Length: 153 aa     
View alignmentsRaw sequence   
>XP_004869832.1
MSASKRVAKELEDLKGEMPPYLRDLCSEKANVLVWHMLLLPVQPPYHLRAFRLRLDFPREYPFRPPTVIFTTRIYHPNVDEQGRTCLPLLSRENWKPHTKAAQVLEALSHLVNRPNLEEPLRLDLANLLARSPEQFWKRAEEFTLQFGEDRPS