Sequence details NCBI ID: XP_004869731.1 (Protein)

Details from NCBI annotation

Gene Symbol Thrsp
Protein Name PREDICTED: thyroid hormone-inducible hepatic protein isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004869674.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004869674.1 (Coding sequence)

Sequence Protein

Length: 149 aa     
View alignmentsRaw sequence   
>XP_004869731.1
MQVLTKHYPKNCLLTVMDRYSAVVHNMEQVVMIPSLLRDVHLTGPGEQAQAPDLYTYFTMLKTIRVEVDHGLLPREEWRAKAAGHQANEAEDDEAVETEEAGEERISRELDLEAQFHLHFSSLHHILTHLTQKAQEVTRKYQEMTGQVL