Sequence details NCBI ID: XP_004869448.1 (Protein)

Details from NCBI annotation

Gene Symbol Vamp1
Protein Name PREDICTED: vesicle-associated membrane protein 1 isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004869391.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004869391.1 (Coding sequence)

Sequence Protein

Length: 132 aa     
View alignmentsRaw sequence   
>XP_004869448.1
MSAPAQPPAEGTEGAAPGGGPPGLPPNMTSNRRLQQTQAQVEEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKVNVLVLLLLFLSSPSLQGCRVSVLQGPLGRKSECLL