Sequence details NCBI ID: XP_004868053.1 (Protein)

Details from NCBI annotation

Gene Symbol Tm4sf20
Protein Name PREDICTED: transmembrane 4 L6 family member 20 [Heterocephalus glaber]

Database interlinks

Part of XM_004867996.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004867996.1 (Coding sequence)

Sequence Protein

Length: 227 aa     
View alignmentsRaw sequence   
>XP_004868053.1
MTCCEGWTSCNGFSLLALLLAGVILNAIPLGINLVEADKVFQNPISCFEWWFPGIIGAGLMVIPATTMSLAARKRACCNNKTGMFLSSLLNVITVIGAAYCMLVSIQALSEGPLVCNSQVNGTANCKFSWKNLTDIHLQPLFLQWFWNDSCVSPTGSTKLNTNNNMSTSWKIPSSNSEEDRYRIFHFSVFLGLLLVGILEALFGLSQIVIGFLGCLCGVSERRSRIV