Sequence details NCBI ID: XP_004867500.1 (Protein)

Details from NCBI annotation

Gene Symbol Cnih4
Protein Name PREDICTED: protein cornichon homolog 4 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004867443.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004867443.1 (Coding sequence)

Sequence Protein

Length: 139 aa     
View alignmentsRaw sequence   
>XP_004867500.1
MEAVVFIFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPEMIGHSIVTVLMLVSLHWFIFLLNLPVVTWNIYRFIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLGFHLLCFFMYLYSMILALIND