Sequence details NCBI ID: XP_004866736.1 (Protein)

Details from NCBI annotation

Gene Symbol Tnnt1
Protein Name PREDICTED: troponin T, slow skeletal muscle isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004866679.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004866679.1 (Coding sequence)

Sequence Protein

Length: 266 aa     
View alignmentsRaw sequence   
>XP_004866736.1
MQRPWIVKAWGTTTWRSVRWGSWWAHVGKVFPLVGVPCSWPLPSARSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELVALKDRIERRRAERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKLRILSERKKPLNIDHMGEEQLRDKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK