Sequence details NCBI ID: XP_004866532.1 (Protein)

Details from NCBI annotation

Gene Symbol Usmg5
Protein Name PREDICTED: up-regulated during skeletal muscle growth protein 5 [Heterocephalus glaber]

Database interlinks

Part of XM_004866475.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004866475.1 (Coding sequence)

Sequence Protein

Length: 60 aa     
Raw sequence   
>XP_004866532.1
MAGPEADAQYQFTGIKKYFNSYTLTGRMNCVLATYGGIALTILYFKLRSKKTKTPAVKAT