Sequence details NCBI ID: XP_004866271.1 (Protein)

Details from NCBI annotation

Gene Symbol Ostc
Protein Name PREDICTED: oligosaccharyltransferase complex subunit OSTC isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004866214.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004866214.1 (Coding sequence)

Sequence Protein

Length: 149 aa     
View alignmentsRaw sequence   
>XP_004866271.1
METLYRVPFLVLECPNLKLKKPPWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYLMG