Sequence details NCBI ID: XP_004865995.1 (Protein)

Details from NCBI annotation

Gene Symbol Mbd3
Protein Name PREDICTED: methyl-CpG-binding domain protein 3 isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004865938.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004865938.1 (Coding sequence)

Sequence Protein

Length: 290 aa     
View alignmentsRaw sequence   
>XP_004865995.1
MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLSAFDIAEELVRTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELARDEAPLDKACGDEEDEEDEEDEEEEPEPDPELERV